SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459820 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459820
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.3e-34
Family DBL homology domain (DH-domain) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459820   Gene: ENSG00000159842   Transcript: ENST00000570441
Sequence length 168
Comment pep:putative chromosome:GRCh38:17:1072733:1115436:-1 gene:ENSG00000159842 transcript:ENST00000570441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIH
KEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQK
ISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTP
Download sequence
Identical sequences A0A2J8JKI0 A0A2J8SNP5 I3L2P5
ENSP00000459820 ENSP00000459820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]