SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000459977 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000459977
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily ALDH-like 7.46e-23
Family ALDH-like 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000459977   Gene: ENSG00000072210   Transcript: ENST00000571163
Sequence length 97
Comment pep:novel chromosome:GRCh38:17:19663374:19675921:1 gene:ENSG00000072210 transcript:ENST00000571163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGND
VIMHFTLNSFPFGGVGRILLKNDPVQPPSASTELFLF
Download sequence
Identical sequences I3L2W1
ENSP00000459977 ENSP00000459977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]