SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000460454 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460454
Domain Number 1 Region: 37-163
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000285
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460454   Gene: ENSG00000004897   Transcript: ENST00000575483
Sequence length 233
Comment pep:novel chromosome:GRCh38:17:47156913:47189252:-1 gene:ENSG00000004897 transcript:ENST00000575483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCL
PNSCTTQVPNHSLSHRQPETVLTETPQDTIVQNKPKTGRSLLGGPAALSPLTP
Download sequence
Identical sequences A0A2J8J9L9 A0A2J8UZ64 I3L3H6
ENSP00000460454 ENSP00000460454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]