SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460770 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460770
Domain Number 1 Region: 50-131
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-20
Family DBL homology domain (DH-domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460770   Gene: ENSG00000159842   Transcript: ENST00000575934
Sequence length 133
Comment pep:novel chromosome:GRCh38:17:1083522:1229004:-1 gene:ENSG00000159842 transcript:ENST00000575934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGPMKPLKATATTSQPVLTIQQIETI
FYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAE
KCSQSNNQFQKIS
Download sequence
Identical sequences A0A2J8JKK8 A0A2J8SNQ3 I3L3W0
ENSP00000460770 ENSP00000460770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]