SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460917 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460917
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-28
Family Kringle modules 0.00087
Further Details:      
 
Domain Number 2 Region: 218-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460917   Gene: ENSG00000131650   Transcript: ENST00000575769
Sequence length 424
Comment pep:known chromosome:GRCh38:16:2964521:2968348:1 gene:ENSG00000131650 transcript:ENST00000575769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLG
TAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGA
PPAAIGARVFSTVTAVSVLLLLLLGLLRPLRRRCGALGQGLRADRWWGAGAPEGNRARKE
LLGS
Download sequence
Identical sequences ENSP00000460917 ENSP00000460917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]