SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460924 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460924
Domain Number 1 Region: 15-95
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.72e-23
Family Ribosomal protein L20 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460924   Gene: ENSG00000242485   Transcript: ENST00000482352
Sequence length 155
Comment pep:putative chromosome:GRCh38:1:1405109:1407290:-1 gene:ENSG00000242485 transcript:ENST00000482352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLK
KKNMRTLWINRITAASQEHGLKYPALIGNLVKVWVSMWVPLKFWTSAETIMRGVVVLPVV
PANQEAEARGSLETDFWAVVCYADGVSMLSVVSIW
Download sequence
Identical sequences ENSP00000460924 ENSP00000460924 ENSP00000459994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]