SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460926 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460926
Domain Number 1 Region: 3-231
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.78e-74
Family Eukaryotic type heme oxygenase 0.000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460926   Gene: ENSG00000103415   Transcript: ENST00000575120
Sequence length 287
Comment pep:putative chromosome:GRCh38:16:4476406:4509836:1 gene:ENSG00000103415 transcript:ENST00000575120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALYFTYSALEEEMERNK
DHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELL
VAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNAL
DLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYA
AEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM
Download sequence
Identical sequences A0A2J8LAN3
NP_001273200.1.87134 NP_001273200.1.92137 ENSP00000460926 ENSP00000460926 ENSP00000483319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]