SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461084 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461084
Domain Number 1 Region: 47-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000000157
Family Chaperone J-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSP00000461084
Domain Number - Region: 217-309
Classification Level Classification E-value
Superfamily Ribosomal protein L1 0.0506
Family Ribosomal protein L1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461084   Gene: ENSG00000262911   Transcript: ENST00000573306
Sequence length 388
Comment pep:known chromosome:GRCh38:CHR_HSCHR21_4_CTG1_1:33497776:33501249:-1 gene:ENSG00000262911 transcript:ENST00000573306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKKKIREYYRLLNVEE
GCSADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNASQSKGEEE
EDVEKFKYKTPQHRHYLSFEGIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQSQYFP
DSVIVKNIRQSKQQKITQAIERLVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMT
HNLNRILIDNGYQPEWILKQKEISDTIEQLREAILVSRKKLGNPMTPTEKKQWNHVCEQF
QENIRKLNKRINDFNLIVPILTRQKVHFDAQKEIVRAQKIYETLIKTKEVTDRNPNNLDQ
GEGEKTPEIKKGFLNWMNLWKFIKIRSF
Download sequence
Identical sequences Q9NX36
ENSP00000320303 ENSP00000461084 ENSP00000320303 ENSP00000371373 ENSP00000385777 ENSP00000461084 ENSP00000461665 ENSP00000461737 ENSP00000479716 ENSP00000483670 NP_001035282.1.87134 NP_001035282.1.92137 NP_001307675.1.87134 NP_001307675.1.92137 NP_060303.2.87134 NP_060303.2.92137 9606.ENSP00000320303 HR3287 ENSP00000320303 ENSP00000371373 ENSP00000385777 ENSP00000461084 ENSP00000461665 ENSP00000461737 gi|40254908|ref|NP_060303.2| gi|93352549|ref|NP_001035282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]