SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461743 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461743
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.51e-20
Family Laminin G-like module 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461743   Gene: ENSG00000129214   Transcript: ENST00000576152
Sequence length 206
Comment pep:novel chromosome:GRCh38:17:7630254:7633354:1 gene:ENSG00000129214 transcript:ENST00000576152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYG
DTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQLVPALDGCLRRDSWLD
KQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGEDSSTSFCLNGLWAQGQRLDVD
QALNRSHEIWTHSCPQSPGNGTDASH
Download sequence
Identical sequences A0A2J8KPC7 B0FWH6
ENSP00000461743 ENSP00000461743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]