SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000461982 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461982
Domain Number 1 Region: 29-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461982   Gene: ENSG00000187607   Transcript: ENST00000472486
Sequence length 106
Comment pep:putative chromosome:GRCh38:17:15699739:15716490:1 gene:ENSG00000187607 transcript:ENST00000472486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGKLDPAQRDVM
LENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSELPFC
Download sequence
Identical sequences J3KRF9
ENSP00000461982 ENSP00000461982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]