SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462183 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462183
Domain Number 1 Region: 131-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000619
Further Details:      
 
Domain Number 2 Region: 40-185,369-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000466
Family C-terminal domain of adrenodoxin reductase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462183   Gene: ENSG00000161513   Transcript: ENST00000582944
Sequence length 483
Comment pep:novel chromosome:GRCh38:17:74862544:74872985:-1 gene:ENSG00000161513 transcript:ENST00000582944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKTAHSGRCAFWGNVEVGRDVTVPELQEAYHA
VVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVA
LDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLP
GARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFF
RSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVD
PSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAG
LLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRL
LGH
Download sequence
Identical sequences A0A0A0MTR6
ENSP00000462183 NP_001244943.2.87134 NP_001244943.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]