SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462933 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462933
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily ALDH-like 0.000000000128
Family ALDH-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462933   Gene: ENSG00000072210   Transcript: ENST00000573947
Sequence length 62
Comment pep:known chromosome:GRCh38:17:19663386:19675779:1 gene:ENSG00000072210 transcript:ENST00000573947 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
IFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKVPVGWELITENIVLILFLISVP
VY
Download sequence
Identical sequences A0A2J8RC87 J3KTD9
ENSP00000462933 ENSP00000462933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]