SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463128 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463128
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily ALDH-like 0.0000223
Family ALDH-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463128   Gene: ENSG00000072210   Transcript: ENST00000578614
Sequence length 54
Comment pep:known chromosome:GRCh38:17:19648778:19656459:1 gene:ENSG00000072210 transcript:ENST00000578614 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKEML
Download sequence
Identical sequences J3QKK9
ENSP00000463128 ENSP00000463128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]