SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463162 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000463162
Domain Number - Region: 33-88
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.085
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463162   Gene: ENSG00000008283   Transcript: ENST00000584031
Sequence length 194
Comment pep:putative chromosome:GRCh38:17:63432305:63446184:-1 gene:ENSG00000008283 transcript:ENST00000584031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGAAAATPTALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG
LIFLQGNALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGEFPGAAFPATCLPLQAWWR
CSTTTGRRATLTCTAYTAGAGSLSLSCTLCSGWWASASSCSPELHSPCGAATAHSTSSLV
LPSSSFPWAPPCWA
Download sequence
Identical sequences J3QKN3
ENSP00000463162 ENSP00000463162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]