SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463213 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463213
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 8.5e-23
Family VPS23 C-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463213   Gene: ENSG00000074319   Transcript: ENST00000584526
Sequence length 77
Comment pep:known chromosome:GRCh38:11:18475219:18481771:-1 gene:ENSG00000074319 transcript:ENST00000584526 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQL
RALMQKARKTAGLSDLY
Download sequence
Identical sequences J3QKS4
ENSP00000463213 ENSP00000463213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]