SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463263 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463263
Domain Number 1 Region: 35-170
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.96e-21
Family Ribosomal protein S7 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463263   Gene: ENSG00000125445   Transcript: ENST00000579761
Sequence length 183
Comment pep:putative chromosome:GRCh38:17:75261674:75264490:1 gene:ENSG00000125445 transcript:ENST00000579761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVNEWPGQESRA
LHM
Download sequence
Identical sequences J3QKW2
ENSP00000463263 ENSP00000463263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]