SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463307 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000463307
Domain Number - Region: 10-74
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0157
Family TrmE connector domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463307   Gene: ENSG00000125686   Transcript: ENST00000577831
Sequence length 97
Comment pep:known chromosome:GRCh38:17:39407714:39451272:-1 gene:ENSG00000125686 transcript:ENST00000577831 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVS
CLETLQKALKVTSLPAMTDRLESIARQNGAVRSLYSS
Download sequence
Identical sequences A0A2I2YFM4 A0A2I3N884 A0A2K6QME3 J3QKZ7
ENSP00000463307 ENSP00000463307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]