SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463388 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463388
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.22e-16
Family G proteins 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463388   Gene: ENSG00000108551   Transcript: ENST00000579152
Sequence length 122
Comment pep:novel chromosome:GRCh38:17:17494707:17496395:-1 gene:ENSG00000108551 transcript:ENST00000579152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTDPRHQVLPQEQNQGERGRAPGHLRQ
QG
Download sequence
Identical sequences A0A2J8J344 A0A2J8RID1 A0A2K5XJW2
NP_001186918.1.87134 NP_001186918.1.92137 XP_003315639.1.37143 XP_004090423.1.23891 XP_008008718.1.81039 XP_009249638.1.23681 XP_010367172.1.97406 XP_011807541.1.43180 XP_011851133.1.47321 XP_011942612.1.92194 XP_017751096.1.44346 gi|317008582|ref|NP_001186918.1| ENSP00000463388 ENSP00000463388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]