SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463683 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463683
Domain Number 1 Region: 64-263
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.79e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463683   Gene: ENSG00000125445   Transcript: ENST00000579002
Sequence length 271
Comment pep:putative chromosome:GRCh38:17:75261912:75266330:1 gene:ENSG00000125445 transcript:ENST00000579002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYLGQGPELLWLRFSSRSPRRSPSSARWQSCLLLSQTYSLVESAFACLLLSPPPRLTQ
VRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVI
SKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKN
CEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLE
AFHNQGPVIKRKHDLHKMAEANRALAHYRWW
Download sequence
Identical sequences J3QLS3
ENSP00000463683 ENSP00000463683 ENSP00000462677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]