SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463810 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000463810
Domain Number - Region: 34-108
Classification Level Classification E-value
Superfamily PHP domain-like 0.0589
Family RNase P subunit p30 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463810   Gene: ENSG00000101577   Transcript: ENST00000584915
Sequence length 129
Comment pep:putative chromosome:GRCh38:18:2954516:2982873:-1 gene:ENSG00000101577 transcript:ENST00000584915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYLEDDKEDEVVCKGSLSKTQDVYHDKSPPGILSQTMNYVGQLAGQVIVTVKELYKGIN
QATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRSKEKVIDIEINGSAVDLHMKLGDN
GEAFFVEET
Download sequence
Identical sequences J3QQN0
ENSP00000463810 ENSP00000463810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]