SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464092 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000464092
Domain Number - Region: 159-258
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0377
Family Endonuclease III 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464092   Gene: ENSG00000135164   Transcript: ENST00000584619
Sequence length 272
Comment pep:known chromosome:GRCh38:7:87152498:87191027:1 gene:ENSG00000135164 transcript:ENST00000584619 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSED
DQSIDDSTPCISVVALPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEIS
PLGNEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDA
TEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVGKYTPEEIEKLKEQLW
TPKKGHTFKLWLSKYCCPQLPNQSNGKKKNEE
Download sequence
Identical sequences A0A2J8LGG7 A0A2J8VLP1
ENSP00000407941 ENSP00000464092 ENSP00000464596 HR755 ENSP00000407941 ENSP00000464092 ENSP00000464596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]