SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464159 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464159
Domain Number 1 Region: 20-66
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000447
Family PUA domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSP00000464159
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.00111
Family Nip7p homolog, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464159   Gene: ENSG00000132603   Transcript: ENST00000562523
Sequence length 70
Comment pep:putative chromosome:GRCh38:16:69340276:69342072:1 gene:ENSG00000132603 transcript:ENST00000562523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYS
MADIPLCLFF
Download sequence
Identical sequences A0A2J8Q3Z0 A0A2J8VVL4 J3QRD6
ENSP00000464159 ENSP00000464159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]