SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464348 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464348
Domain Number 1 Region: 22-73
Classification Level Classification E-value
Superfamily PUA domain-like 7.18e-16
Family PUA domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSP00000464348
Domain Number - Region: 2-21
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.000216
Family Nip7p homolog, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464348   Gene: ENSG00000132603   Transcript: ENST00000567202
Sequence length 79
Comment pep:putative chromosome:GRCh38:16:69340271:69342054:1 gene:ENSG00000132603 transcript:ENST00000567202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVV
YSMADIPLTLGNMCGMKRR
Download sequence
Identical sequences J3QRR4
ENSP00000464348 ENSP00000464348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]