SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464386 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464386
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.7e-20
Family VPS23 C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464386   Gene: ENSG00000074319   Transcript: ENST00000580814
Sequence length 63
Comment pep:known chromosome:GRCh38:11:18469031:18481731:-1 gene:ENSG00000074319 transcript:ENST00000580814 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
ILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLS
DLY
Download sequence
Identical sequences A0A2J8P4R0 A0A2J8UQN7 J3QRU6
ENSP00000464386 ENSP00000464386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]