SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464453 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464453
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily ALDH-like 7.07e-33
Family ALDH-like 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464453   Gene: ENSG00000072210   Transcript: ENST00000578696
Sequence length 134
Comment pep:novel chromosome:GRCh38:17:19656488:19663361:1 gene:ENSG00000072210 transcript:ENST00000578696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKHLTPVTLELGGKSPCYIDKDCDLDIVCSCSGCFPLRRITWGKYMNCGQTCIAPDYILC
EASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKIAFGGETDEA
TRYIAPTVLTDVDP
Download sequence
Identical sequences J3QS00
ENSP00000464453 ENSP00000464453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]