SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464646 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464646
Domain Number 1 Region: 105-166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000289
Family Extended AAA-ATPase domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSP00000464646
Domain Number - Region: 40-69
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00068
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464646   Gene: ENSG00000087191   Transcript: ENST00000584536
Sequence length 169
Comment pep:known chromosome:GRCh38:17:63827472:63831425:1 gene:ENSG00000087191 transcript:ENST00000584536 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVTPNCRVALRNDSYTLHKILPNKVDPLVSLMM
VEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGQEW
Download sequence
Identical sequences A0A1D5R6G1 A0A2I2V1H7 A0A2I3GV43 A0A2I3N100 A0A2I3TBW8 A0A2J8UZM5 A0A2K5DX99 A0A2K5K9P6 A0A2K5M5K9 A0A2K5VK67 A0A2K5XQ80 A0A2K6CP70 A0A2K6KH56 A0A2K6RIR1 G3SIH4 J3QSE0
ENSP00000464646 ENSP00000464646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]