SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000464696 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464696
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSP00000464696
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0265
Family BphP N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464696   Gene: ENSG00000179094   Transcript: ENST00000581395
Sequence length 572
Comment pep:known chromosome:GRCh38:17:8144056:8156506:-1 gene:ENSG00000179094 transcript:ENST00000581395 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLQNQDTFSVAVSFLTGRIVYISEQAAV
LLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGAVTSPGPLHSPGSSSDSNGGDAEGPGP
PAPLQARSRPRPFPANPQTQSWRRVLLPSRPH
Download sequence
Identical sequences J3QSH9
ENSP00000464696 ENSP00000464696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]