SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464849 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464849
Domain Number 1 Region: 49-266
Classification Level Classification E-value
Superfamily EF-hand 4.54e-65
Family Penta-EF-hand proteins 0.0000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464849   Gene: ENSG00000126247   Transcript: ENST00000588815
Sequence length 268
Comment pep:known chromosome:GRCh38:19:36140127:36150352:1 gene:ENSG00000126247 transcript:ENST00000588815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR
ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL
MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ
FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF
RAFKSLDKDGTGQIQVNIQEWLQLTMYS
Download sequence
Identical sequences H2NYJ9 P04632
9600.ENSPPYP00000011080 9606.ENSP00000246533 NP_001003962.1.87134 NP_001003962.1.92137 NP_001289561.1.87134 NP_001289561.1.92137 NP_001740.1.87134 NP_001740.1.92137 XP_002829147.1.23681 XP_002829148.1.23681 XP_009230760.1.23681 ENSP00000246533 ENSP00000464849 gi|4502565|ref|NP_001740.1| gi|51599151|ref|NP_001003962.1| ENSPPYP00000011080 ENSP00000246533 ENSP00000464849 ENSPPYP00000011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]