SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464874 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464874
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.73e-60
Family Enolase N-terminal domain-like 0.000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464874   Gene: ENSG00000108515   Transcript: ENST00000521811
Sequence length 148
Comment pep:known chromosome:GRCh38:17:4951080:4953845:1 gene:ENSG00000108515 transcript:ENST00000521811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGK
GVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK
AGAAEKGVPLYRHIADLAGNPDLILPVP
Download sequence
Identical sequences A0A2J8KQK5 E5RI09
ENSP00000428502 ENSP00000464874 ENSP00000428502 ENSP00000464874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]