SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465584 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000465584
Domain Number - Region: 5-44
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0129
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465584   Gene: ENSG00000185379   Transcript: ENST00000586044
Sequence length 49
Comment pep:known chromosome:GRCh38:17:35100383:35119746:-1 gene:ENSG00000185379 transcript:ENST00000586044 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKS
Download sequence
Identical sequences ENSP00000465366 ENSP00000465584 ENSP00000465366 ENSP00000465584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]