SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465979 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465979
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.06e-21
Family Ubiquitin-related 0.0000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465979   Gene: ENSG00000105254   Transcript: ENST00000591296
Sequence length 133
Comment pep:putative chromosome:GRCh38:19:36115612:36120763:1 gene:ENSG00000105254 transcript:ENST00000591296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSY
PVDDGCRIHSLALSPRLACSGMISAHCNLRLPGSSDSPASASRVGGITDARHYTRVIDHS
GARLGEYEDVSRV
Download sequence
Identical sequences K7EL99
ENSP00000465979 ENSP00000465979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]