SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466022 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466022
Domain Number 1 Region: 58-124
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.25e-21
Family Leucine zipper domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466022   Gene: ENSG00000153879   Transcript: ENST00000585933
Sequence length 150
Comment pep:known chromosome:GRCh38:19:33374312:33382686:1 gene:ENSG00000153879 transcript:ENST00000585933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD
LFLEHAHNLADNVQSISTENTTADGDNAGQ
Download sequence
Identical sequences H2NYC5 P53567
gi|4502769|ref|NP_001797.1| GO.35172 HR6439 9600.ENSPPYP00000011005 9606.ENSP00000284000 ENSPPYP00000011005 ENSP00000284000 ENSP00000466022 ENSPPYP00000011005 ENSP00000284000 ENSP00000466022 ENSP00000284000 NP_001239225.1.87134 NP_001239225.1.92137 NP_001797.1.87134 NP_001797.1.92137 XP_003816246.1.60992 XP_003816247.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]