SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466307 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000466307
Domain Number - Region: 49-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0196
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466307   Gene: ENSG00000091947   Transcript: ENST00000587529
Sequence length 171
Comment pep:putative chromosome:GRCh38:17:44012509:44014952:-1 gene:ENSG00000091947 transcript:ENST00000587529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVVCWGTVGWRCLAGSEL
Download sequence
Identical sequences A0A2J8UY94 K7EM07
ENSP00000466307 ENSP00000466307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]