SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466480 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000466480
Domain Number - Region: 9-36
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000863
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466480   Gene: ENSG00000091157   Transcript: ENST00000585669
Sequence length 40
Comment pep:putative chromosome:GRCh38:18:56962435:57010314:1 gene:ENSG00000091157 transcript:ENST00000585669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMVSYYERNHRIAVGARHGSVALYDIRTGKCQALYQAKER
Download sequence
Identical sequences K7EMF3
ENSP00000466480 ENSP00000466480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]