SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466814 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466814
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily ALDH-like 3.27e-26
Family ALDH-like 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466814   Gene: ENSG00000072210   Transcript: ENST00000584332
Sequence length 127
Comment pep:putative chromosome:GRCh38:17:19648751:19656370:1 gene:ENSG00000072210 transcript:ENST00000584332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTML
DEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLP
QYLDQDL
Download sequence
Identical sequences ENSP00000466814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]