SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466821 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000466821
Domain Number - Region: 16-57
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0252
Family Type 2 phosphatidic acid phosphatase, PAP2 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466821   Gene: ENSG00000141349   Transcript: ENST00000593115
Sequence length 73
Comment pep:known chromosome:GRCh38:17:44070745:44074187:1 gene:ENSG00000141349 transcript:ENST00000593115 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWI
SLITEWLNLIFKW
Download sequence
Identical sequences A0A2J8J4C2 A0A2J8UYA3 K7ENK1
ENSP00000466821 ENSP00000466983 ENSP00000466821 ENSP00000466983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]