SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466857 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466857
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 4.9e-81
Family Arrestin/Vps26-like 0.000000116
Further Details:      
 
Domain Number 2 Region: 178-265
Classification Level Classification E-value
Superfamily E set domains 2.8e-30
Family Arrestin/Vps26-like 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466857   Gene: ENSG00000141480   Transcript: ENST00000575877
Sequence length 330
Comment pep:putative chromosome:GRCh38:17:4710699:4721496:1 gene:ENSG00000141480 transcript:ENST00000575877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQREGGCQQGGAGNPGVLQGQGEAGGVSRRGCLCGAAFCS
YAPQAPRPHPPPQTPVSRSGDRCPCGHQPH
Download sequence
Identical sequences K7ENA6
NP_001244258.1.87134 NP_001244258.1.92137 ENSP00000466857 ENSP00000466857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]