SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467060 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467060
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000034
Family Cgl1923-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467060   Gene: ENSG00000128789   Transcript: ENST00000590217
Sequence length 240
Comment pep:putative chromosome:GRCh38:18:12703023:12724868:1 gene:ENSG00000128789 transcript:ENST00000590217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLVSSIIA
Download sequence
Identical sequences K7ENR6
ENSP00000467060 ENSP00000467060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]