SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467311 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467311
Domain Number 1 Region: 119-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.25e-33
Family cAMP-binding domain 0.000000558
Further Details:      
 
Domain Number 2 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.33e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 
Domain Number 3 Region: 243-297
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000589
Family cAMP-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467311   Gene: ENSG00000108946   Transcript: ENST00000585981
Sequence length 297
Comment pep:known chromosome:GRCh38:17:68512882:68528992:1 gene:ENSG00000108946 transcript:ENST00000585981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILE
Download sequence
Identical sequences A0A2J8KKN0 A0A2J8V091 K7EPB2
ENSP00000467311 ENSP00000467311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]