SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467545 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000467545
Domain Number - Region: 1-38
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0196
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467545   Gene: ENSG00000091947   Transcript: ENST00000590905
Sequence length 51
Comment pep:putative chromosome:GRCh38:17:44013146:44019447:-1 gene:ENSG00000091947 transcript:ENST00000590905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRM
Download sequence
Identical sequences A0A2J8J4B8 A0A2J8UYA6 K7EPU9
ENSP00000467545 ENSP00000467545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]