SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467568 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467568
Domain Number 1 Region: 196-390
Classification Level Classification E-value
Superfamily E set domains 9.33e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 94-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-21
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467568   Gene: ENSG00000153822   Transcript: ENST00000586462
Sequence length 457
Comment pep:putative chromosome:GRCh38:17:70096640:70133604:1 gene:ENSG00000153822 transcript:ENST00000586462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILQKCRKVLTENPNQEIATSLEFLLLQNSPGSLRAQQRMSYYGSSYHIINADAKYPGYP
PEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSY
ILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVTE
ECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMW
RIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHES
PLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYY
KVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVS
SCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences K7EPW9
ENSP00000376439 ENSP00000467568 ENSP00000467568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]