SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000467905 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000467905
Domain Number - Region: 3-19
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 0.0123
Family Eukaryotic RPB5 N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467905   Gene: ENSG00000099817   Transcript: ENST00000589737
Sequence length 51
Comment pep:known chromosome:GRCh38:19:1088148:1095375:-1 gene:ENSG00000099817 transcript:ENST00000589737 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDDEEETYRLWKIRKTIMQRSPRWASRPSRCTASACRRRTSHGLSSWCSRA
Download sequence
Identical sequences A0A2I2Z164 A0A2I3T4C6 K7EQN2
ENSP00000467905 ENSP00000467905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]