SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468866 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468866
Domain Number 1 Region: 15-77
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000267
Family Eps15 homology domain (EH domain) 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468866   Gene: ENSG00000127527   Transcript: ENST00000602151
Sequence length 90
Comment pep:putative chromosome:GRCh38:19:16440653:16471943:-1 gene:ENSG00000127527 transcript:ENST00000602151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQVYTHVHRANGGAGQSPQAG
Download sequence
Identical sequences M0QX30
ENSP00000468866 ENSP00000468866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]