SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469365 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469365
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-20
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 87-186
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469365   Gene: ENSG00000152767   Transcript: ENST00000596256
Sequence length 248
Comment pep:novel chromosome:GRCh38:13:98431081:98440796:1 gene:ENSG00000152767 transcript:ENST00000596256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSH
ADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGRFNDVLLYTS
RGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVED
IQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNT
MVHVCWHR
Download sequence
Identical sequences M0QXT1
ENSP00000469365 ENSP00000469365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]