SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469450
Domain Number 1 Region: 184-361
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-44
Family DBL homology domain (DH-domain) 0.000000089
Further Details:      
 
Domain Number 2 Region: 2-203
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.3e-40
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 348-510
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-34
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 4 Region: 601-721
Classification Level Classification E-value
Superfamily SH2 domain 3.87e-26
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 5 Region: 749-807
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-22
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469450   Gene: ENSG00000141968   Transcript: ENST00000596764
Sequence length 813
Comment pep:known chromosome:GRCh38:19:6772728:6857360:1 gene:ENSG00000141968 transcript:ENST00000596764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIK
YKERFLVYGRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQR
VLKYHLLLQELVKHTQEAMEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIEN
LDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLLDKALLICKRRGDSYDLKDFVNLHSF
QVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRELKKKWMEQFEMAISNIYPENAT
ANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFP
GTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEA
EQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGT
FLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKD
CFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKIL
NKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Download sequence
Identical sequences A0A2I3S3W3
ENSP00000469450 ENSP00000469450 NP_001245136.1.87134 NP_001245136.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]