SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469456 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000469456
Domain Number - Region: 13-63
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0251
Family alpha-mannosidase, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469456   Gene: ENSG00000104774   Transcript: ENST00000596591
Sequence length 67
Comment pep:known chromosome:GRCh38:19:12652192:12656578:-1 gene:ENSG00000104774 transcript:ENST00000596591 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPAL
TIENEGC
Download sequence
Identical sequences M0QXY0
ENSP00000469456 ENSP00000469456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]