SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469499 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469499
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-25
Family SH3-domain 0.000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469499   Gene: ENSG00000261857   Transcript: ENST00000597784
Sequence length 131
Comment pep:known chromosome:GRCh38:19:40775264:40777427:1 gene:ENSG00000261857 transcript:ENST00000597784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCR
FLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVD
VKTDKWDFYCQ
Download sequence
Identical sequences A0A024R0P1 H2QGD3 Q16674
gi|321400133|ref|NP_001189482.1| gi|5729925|ref|NP_006524.1| ENSPTRP00000018889 9598.ENSPTRP00000018889 9606.ENSP00000263369 ENSPTRP00000018889 ENSP00000263369 NP_001189482.1.87134 NP_001189482.1.92137 NP_006524.1.87134 NP_006524.1.92137 XP_003812519.1.60992 XP_512675.1.37143 ENSP00000263369 ENSP00000469499 ENSP00000470129 ENSP00000263369 ENSP00000469499 ENSP00000470129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]