SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469507 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000469507
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily ALDH-like 0.000573
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469507   Gene: ENSG00000161618   Transcript: ENST00000600265
Sequence length 163
Comment pep:known chromosome:GRCh38:19:49464439:49468945:1 gene:ENSG00000161618 transcript:ENST00000600265 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
INAHGLRDPSVPTGGCKESGCSWHGGPDGLYEYLRPSGTPARLSCLSKNLNYDTFGLAVP
STLPAGPEIGPSPAPPYGLFVGGRFQAPGARSSRPIRDSSGNLHGYVAEGGAKDIRAGRA
SPQEPGQPCCGPWRLHWSAGSLPWPRGWRGRERSSRLRRRRWS
Download sequence
Identical sequences M0QY06
ENSP00000469507 ENSP00000469507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]