SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469585 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000469585
Domain Number - Region: 37-112
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 0.0549
Family IlvD/EDD C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469585   Gene: ENSG00000105698   Transcript: ENST00000598058
Sequence length 170
Comment pep:putative chromosome:GRCh38:19:35269115:35270097:1 gene:ENSG00000105698 transcript:ENST00000598058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNI
QYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQ
RPGPAAASVPPGPAAPFPLVGALPPLGGGGREWRGDTGSALGEPRGWGRC
Download sequence
Identical sequences M0QY46
ENSP00000469585 ENSP00000469585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]