SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000470551 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470551
Domain Number 1 Region: 31-76
Classification Level Classification E-value
Superfamily Kringle-like 4e-17
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 2 Region: 2-23
Classification Level Classification E-value
Superfamily Kringle-like 0.00000314
Family Fibronectin type II module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470551   Gene: ENSG00000169393   Transcript: ENST00000593413
Sequence length 76
Comment pep:known chromosome:GRCh38:19:48019805:48025148:1 gene:ENSG00000169393 transcript:ENST00000593413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVW
CATSYNYDQDHTWVYC
Download sequence
Identical sequences M0QZH6
ENSP00000470551 ENSP00000470551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]